Mazdutide – Premium Research Peptide for Metabolic Science

Welcome to Liaocheng Yixin Company, your trusted source for premium mazdutide peptide for research. As a specialized peptide synthesis manufacturer operating from our facility at No. 9 Lushan Road, Dongcheng Street, Liaocheng Economic and Technological Development Zone, Shandong Province, we provide high-quality research compounds for the global scientific community.

Mazdutide represents a significant advancement in metabolic research as a synthetic analog of the natural mammalian peptide oxyntomodulin . Unlike single-pathway interventions, mazdutide acts as a dual agonist that simultaneously activates both the GLP-1 receptor and the glucagon receptor . Our mazdutide peptide for research offers investigators a reliable, high-purity compound for metabolic and endocrinology studies.

What is Mazdutide?

Mazdutide (also known as IBI-362, LY-3305677, or OXM-3) is a long-acting synthetic oxyntomodulin analog developed as a dual agonist of the glucagon-like peptide-1 receptor (GLP-1R) and glucagon receptor (GCGR) . It is administered as a once-weekly subcutaneous injection in clinical research settings .

Key identifiers:

• CAS Number: 2259884-03-0 

• Molecular Formula: C210H322N46O67 

• Molecular Weight: 4563.06 g/mol 

• Synonyms: IBI-362, LY-3305677, OXM-3 

• Sequence: HXQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG 

• Purity: ≥99% verified by HPLC

Mechanism of Action in Research

Mazdutide’s research significance stems from its unique dual receptor activation profile:

• GLP-1 receptor agonism: Promotes insulin secretion, suppresses appetite, and supports glycemic control 

• Glucagon receptor activation: Enhances energy expenditure and metabolic rate 

• Combined benefits: Research indicates that dual GLP-1R/GCGR activation confers metabolic benefits beyond single GLP-1R agonism alone 

Scientific Research Applications

Mazdutide has been extensively studied in peer-reviewed research across multiple domains:

Weight Management Research

Research demonstrates mazdutide’s significant efficacy in weight reduction:

• A Phase 1 study showed that adults with overweight or obesity achieved approximately 20% weight loss after 20 weeks of treatment with mazdutide at a 16 mg target dose 

• A Phase 3 trial (GLORY-2) demonstrated that once-weekly 9 mg mazdutide significantly reduced weight by 16.65% in Chinese adults with obesity, compared to 1.50% in the placebo group 

• A meta-analysis of five randomized controlled trials confirmed that mazdutide significantly reduced percentage body weight (MD = -12.42%) and waist circumference (MD = -7.98 cm) 

Metabolic Health Research

Mazdutide has demonstrated broader metabolic benefits:

• Significant improvements in systolic blood pressure, triglycerides, non-HDL cholesterol, and LDL cholesterol 

• Reduction in liver enzymes and uric acid levels in clinical research 

• In hyperuricemic rat models, mazdutide significantly reduced serum uric acid levels by enhancing fatty acid oxidation and regulating energy metabolism in hepatocytes 

Liver Disease Research (MAFLD)

Preclinical studies in diet-induced obese (DIO) mouse models showed:

• Mazdutide alleviated hepatic lipid deposition, oxidative stress, and inflammatory responses 

• At only one-third the dose of semaglutide, mazdutide achieved comparable glucose-lowering effects and more pronounced weight loss 

• Multi-omics analysis revealed reprogramming of hepatic lipid metabolism through modulation of the PPAR signaling pathway 

Cardiovascular Research

An ongoing multicenter, randomized, double-blind, placebo-controlled trial is evaluating the effect of 52 weeks of mazdutide treatment on coronary plaque progression in patients with coronary atherosclerosis and overweight or obesity . This research examines potential cardiovascular protective benefits beyond weight management.

Why Choose Liaocheng Yixin Company?

When sourcing mazdutide peptide for research, quality and reliability are paramount. Here’s why researchers trust us:

Manufacturer-Direct Quality

We are a legitimate, licensed peptide synthesis company with a physical headquarters in Shandong Province, China. Our facility maintains strict quality control standards.

Verified Purity Standards

Every batch undergoes rigorous testing using HPLC analysis. Our mazdutide peptide meets ≥99% purity standards. Certificates of Analysis are available upon request.

Research-Grade Specifications

• Purity: ≥99% verified by HPLC

• Appearance: White lyophilized powder

• Storage: Store powder at -20°C in a sealed container, protected from light and moisture

• Form: Lyophilized powder for research use

Quality Assurance & Testing

Every batch undergoes comprehensive quality control:

1. Synthesis by experienced chemists using advanced techniques

2. Purification via preparative HPLC

3. Analysis using HPLC for purity verification

4. Mass Spectrometry for molecular weight confirmation

5. Packaged in sterile conditions for research use

When you need premium mazdutide peptide for research for your metabolic, endocrinology, or cardiovascular studies, choose a manufacturer that prioritizes quality, transparency, and reliability. Liaocheng Yixin Company combines expert peptide synthesis capabilities with rigorous quality control to deliver research materials you can trust.