VIP (6mg) – Premium Neuropeptide for Research Applications

Welcome to Liaocheng Yixin Company, your trusted source for premium vip 6mg peptide for research. As a specialized peptide synthesis manufacturer operating from our facility at No. 9 Lushan Road, Dongcheng Street, Liaocheng Economic and Technological Development Zone, Shandong Province, we provide high-quality research compounds for the global scientific community.

Vasoactive Intestinal Peptide (VIP) is a 28-amino-acid linear neuropeptide first isolated from porcine small intestine by Said and Mutt in 1970 . It is now recognized as one of the most functionally diverse neuropeptides in human physiology, with roles spanning immunology, neuroscience, pulmonary medicine, and circadian biology . Our vip 6mg peptide for research offers investigators a reliable, high-purity compound for studies exploring its pleiotropic biological activities.

What is VIP?

VIP is a 28-amino-acid neuropeptide with the sequence His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 . It is synthesized as a precursor molecule of 170 amino acids containing a signal peptide, which is then cleaved to the active 28-amino-acid peptide . The VIP peptide is remarkably conserved across species and is identical in human, cow, pig, rat, dog, and goat .

Key identifiers:

• Molecular Weight: Approximately 3326 Da 

• Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 

• Gene Location: VIP, 6q25.2 

• Synonyms: Vasoactive Intestinal Polypeptide, PHM27 

• Purity: ≥99% verified by HPLC

• vip 6mg peptide for research

Mechanism of Action in Research

VIP signals through two G-protein-coupled receptors: VPAC1 and VPAC2, which couple to Gs proteins, activating adenylyl cyclase and raising intracellular cAMP levels . This activates the cAMP/PKA/CREB signaling cascade, mediating most of VIP’s biological effects .

Key signaling pathways:

• Anti-inflammatory mechanism: VIP shifts T-cell differentiation from pro-inflammatory Th1/Th17 phenotypes toward regulatory Th2/Treg phenotypes . It suppresses NF-kB-dependent transcription in macrophages, reducing production of TNF-alpha, IL-6, IL-12, and nitric oxide .

• Transcriptional modulation: VIP inhibits the activity of key transcriptional regulators including PU.1 and NFкB, which transcribe arrays of inflammatory proteins . This broad immunomodulatory effect is central to VIP’s therapeutic potential in diverse inflammatory diseases .

• Immune modulation: VIP promotes generation of CD4+CD25+FoxP3+ regulatory T-cells that actively suppress autoimmune and inflammatory responses .

Scientific Research Applications

VIP has been studied extensively across multiple research domains:

Immunology and Inflammation Research

VIP’s anti-inflammatory mechanism is among the most thoroughly characterized of any endogenous peptide. In the immune system, VIP modulates both innate and adaptive immunity . Research has demonstrated its role in:

• Suppressing TLR4 expression in macrophages 

• Inhibiting TNF-alpha and IL-6 production 

• Promoting regulatory T-cell generation and maintaining immune tolerance 

• Preventing microglial activation in models of Parkinson’s disease 

• vip 6mg peptide for research

Cardiovascular Research

vip 6mg peptide for research

VIP serves as a potent vasodilator and regulates smooth muscle activity, epithelial cell secretion, and blood flow in the gastrointestinal tract . Research has suggested that VIP may play a role in reducing cardiac fibrosis through downregulation of the renin-angiotensin system .

Neuroprotection and Brain Research

VIP helps maintain the blood-brain barrier and reduce oxidative stress . In the brain, VIP serves as the dominant synchronizing signal in the suprachiasmatic nucleus (SCN), the brain’s master circadian clock . VIP neurons in the SCN coordinate the firing patterns of neighboring clock neurons, maintaining coherent circadian rhythms . Research has also explored VIP’s neuroprotective effects against glutamate excitotoxicity and microglial activation .

Gastrointestinal and Pulmonary Research

VIP regulates smooth muscle activity, epithelial cell secretion, and blood flow in the gastrointestinal tract . It also functions as a bronchodilator and pulmonary vasodilator . Research has investigated VIP’s potential role in managing inflammatory bowel disease, lung disorders, and cardiac fibrosis .

Why Choose Liaocheng Yixin Company?

When sourcing vip 6mg peptide for research, quality and reliability are paramount. Here’s why researchers trust us:

Manufacturer-Direct Quality

We are a legitimate, licensed peptide synthesis company with a physical headquarters in Shandong Province, China. Our facility maintains strict quality control standards.

Verified Purity Standards

Every batch undergoes rigorous testing using HPLC analysis. Certificates of Analysis are available upon request.

Research-Grade Specifications

• Purity: ≥99% verified by HPLC

• Molecular Weight: ~3326 Da

• Appearance: Lyophilized powder

• Storage: Store powder at -20°C in a sealed, desiccated container, protected from light and moisture

• Form: Lyophilized powder for research use

• vip 6mg peptide for research

Quality Assurance & Testing

Every batch undergoes comprehensive quality control:

1. Synthesis by experienced chemists using solid-phase peptide synthesis

2. Purification via preparative HPLC

3. Analysis using HPLC for purity verification

4. Mass Spectrometry for molecular weight confirmation

5. Packaged in sterile conditions for research use

: What is Vasoactive Intestinal Peptide (VIP) and how does it work in research?

A: VIP is a 28-amino-acid neuropeptide that signals through VPAC1 and VPAC2 receptors, activating the cAMP/PKA/CREB pathway. It functions as a potent anti-inflammatory and immunomodulatory agent, shifting T-cell differentiation toward regulatory phenotypes and suppressing pro-inflammatory cytokine production .

: What are the key research applications for VIP?

A: VIP is used in immunology research (inflammation, autoimmune disease models), neuroscience (neuroprotection, circadian rhythm studies), cardiovascular research (vasodilation, cardiac fibrosis), and gastrointestinal studies .

: How does VIP affect the immune system?

A: VIP suppresses NF-kB-dependent transcription, reduces TNF-alpha, IL-6, and IL-12 production, promotes regulatory T-cell generation, and modulates both innate and adaptive immunity through effects on macrophages, dendritic cells, and T-cells .

: What purity level can I expect?

A: All batches are tested to ensure ≥99% purity by HPLC analysis. Certificates of Analysis are available upon request. vip 6mg peptide for research

: Is this product for human use?

A: No. Our VIP is manufactured strictly for research use only (RUO). It is not intended for human consumption or clinical applications.

When you need premium vip 6mg peptide for research for your immunology, neuroscience, or cardiovascular studies, choose a manufacturer that prioritizes quality, transparency, and reliability. Liaocheng Yixin Company combines expert peptide synthesis capabilities with rigorous quality control to deliver research materials you can trust.