PNC-27 (5mg) – Premium Anti-Cancer Peptide for Research

Welcome to Liaocheng Yixin Company, your trusted source for premium pnc-27 5mg peptide for research. As a specialized peptide synthesis manufacturer operating from our facility in Shandong Province, China, we provide high-quality research compounds for the global scientific community.

PNC-27 is a 32-residue chimeric anti-cancer peptide that represents a unique approach to oncology research . It consists of an HDM-2-binding domain derived from p53 linked to a membrane residency peptide that facilitates penetration of the tumor cell plasma membrane . Our pnc-27 5mg peptide for research offers investigators a reliable, high-purity compound for cancer biology, apoptosis, and tumor suppression studies.

• pnc-27 5mg peptide for research

What is PNC-27?

PNC-27 is an anti-cancer peptide that targets HDM-2 through its p53-like structure, inducing selective membrane pore formation that leads to cancer cell lysis . The peptide contains a carboxy terminal p53 leader sequence (amino acids 12-26) linked to a membrane residency peptide, which enables it to cross cell membranes and reach its targets .

Key identifiers:

• CAS Number: 1159861-00-3 

• Molecular Formula: C188H293N53O44S 

• Molecular Weight: 4031.73 g/mol 

• Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG 

• Synonyms: HDM2-binding Peptide PNC-27 

• Purity: ≥99% verified by HPLC

• pnc-27 5mg peptide for research

Mechanism of Action in Research

PNC-27 operates through a unique, dual-targeting mechanism that has been the subject of recent peer-reviewed research.

HDM-2 Binding and Pore Formation

PNC-27 binds to the p53 binding site of HDM-2 (residues 1-109) in the cancer cell membrane . This binding induces transmembrane pore formation, causing the extrusion of intracellular contents and cancer cell necrosis—a process termed “poptosis” . Immuno-scanning electron microscopy has revealed that PNC-27 bound to HDM-2 forms ring-shaped structures in pores near the cell surface, with approximately 1:1 ratios of PNC-27 to HDM-2 .

Cancer Cell Selectivity

The mechanism involves binding to HDM-2 proteins, which are expressed in the membranes of cancer cells but not in normal (untransformed) cells . This selectivity explains why PNC-27 kills cancer cells while leaving normal cells unharmed. Research has demonstrated that monoclonal antibodies to the p53 binding site of HDM-2 block PNC-27-induced cancer cell necrosis, confirming the specificity of this interaction .

Mitochondrial Disruption

Beyond membrane pore formation, PNC-27 enters cancer cells and binds to mitochondrial membranes, resulting in their disruption . Treated cancer cells fail to retain mitotracker dye, indicating mitochondrial damage, while their lysosomes remain intact .

• pnc-27 5mg peptide for research

Scientific Research Applications

PNC-27 has been studied across multiple cancer research domains:

Oncology and Cancer Cell Biology

PNC-27 has demonstrated cytotoxicity across various cancer cell lines:

• Cervical cancer: Shows cytotoxicity at low doses (IC50=12.4 μM) to human HTB-35 cervical cancer squamous epithelial cells, with no effect on normal PCS-480 cells 

• Acute myeloid leukemia: Exhibits anti-leukemic activity in vivo (40 mg/kg; intraperitoneal injection; 2-3 weeks) 

• Breast cancer: Induces rapid cell death, eliminating ~70% of cells within 2 hours and nearly 100% within 9 hours at effective concentrations 

• Ovarian and other solid tumors: Research has explored ex vivo efficacy in patient-derived epithelial ovarian cancer 

Drug Delivery and Targeting Research

PNC-27 has been investigated in nanoparticle-based delivery systems. Studies have evaluated PNC-27-conjugated PEI-superparamagnetic iron oxide nanoparticles as a potential double-targeting agent for early cancer diagnosis, with applications in HT-29 and CT-26 cell lines .

Selective Cytotoxicity Studies

The peptide’s ability to kill cancer cells while sparing normal cells makes it valuable for research into tumor-selective therapies. Normal cervical epithelial cells (PCS-480) do not express membrane-bound HDM-2 and are unaffected by PNC-27 treatment .

• pnc-27 5mg peptide for research

Why Choose Liaocheng Yixin Company?

When sourcing pnc-27 5mg peptide for research, quality and reliability are paramount. Here’s why researchers trust us:

Manufacturer-Direct Quality

We are a legitimate, licensed peptide synthesis company with a physical headquarters in Shandong Province, China. Our facility maintains strict quality control standards and adheres to rigorous synthesis protocols.

Verified Purity Standards

Every batch undergoes rigorous testing using HPLC and mass spectrometry. Our PNC-27 meets ≥99% purity standards. Certificates of Analysis are available upon request.

Research-Grade Specifications

• Purity: ≥99% verified by HPLC

• CAS Number: 1159861-00-3

• pnc-27 5mg peptide for research

• Molecular Weight: 4031.73 g/mol

• Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

• Appearance: White to off-white lyophilized powder 

• Storage: Store powder at -20°C in a sealed, desiccated container, protected from light and moisture 

Quality Assurance & Testing

Every batch undergoes comprehensive quality control:

1. Synthesis by experienced chemists using solid-phase peptide synthesis

2. Purification via preparative HPLC

3. Analysis using HPLC for purity verification

4. Mass Spectrometry for molecular weight confirmation

5. Packaged under sterile conditions for research use

6. pnc-27 5mg peptide for research

: What is PNC-27 and how does it work in research?

A: PNC-27 is a 32-residue chimeric peptide that targets HDM-2 in cancer cell membranes . It binds to the p53 binding site of HDM-2, inducing transmembrane pore formation and mitochondrial disruption, leading to selective cancer cell necrosis. The peptide is cytotoxic to cancer cells but not normal cells .: What distinguishes PNC-27 from other anti-cancer peptides?

A: PNC-27 operates through a unique dual mechanism: it forms pores in cancer cell membranes by binding to membrane-expressed HDM-2 and also enters cells to disrupt mitochondrial membranes . This process is independent of p53 activity, making it effective in p53-mutant cancers .

: What research applications use PNC-27?

A: PNC-27 is used in oncology research (cervical cancer, leukemia, breast cancer, ovarian cancer studies), drug delivery research (nanoparticle conjugation), and selective cytotoxicity studies .

: What is the evidence for PNC-27’s selectivity?

A: Research demonstrates that PNC-27 is cytotoxic to cervical cancer cells (IC50=12.4 μM) but not to normal cervical epithelial cells . This selectivity is due to HDM-2 expression in cancer cell membranes, which is absent in normal cells .

: What purity level can I expect?

A: All batches are tested to ensure ≥99% purity by HPLC analysis. Certificates of Analysis are available upon request.

: Is this product for human use?

A: No. Our PNC-27 is manufactured strictly for research use only (RUO). It is not intended for human consumption or clinical applications .

When you need premium pnc-27 5mg peptide for research for your oncology, apoptosis, or cancer biology studies, choose a manufacturer that prioritizes quality, transparency, and reliability. Liaocheng Yixin Company combines expert peptide synthesis capabilities with rigorous quality control to deliver research materials you can trust.